PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G12720.1
Common NameATMYB67, ATY53, MYB67
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 307aa    MW: 34744.3 Da    PI: 7.056
Description myb domain protein 67
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G12720.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-182471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G ++W+++++  g+ R++k+c++rw +yl
      AT3G12720.1 24 RGLWSPEEDEKLLRYITTHGHPSWSSVPKLAGLQRCGKSCRLRWINYL 71
                     788*******************************************97 PP

2Myb_DNA-binding53.36.5e-1777120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++ +eE+++++d+++ lG++ W+ Ia++++ gRt++++k++w++
      AT3G12720.1  77 RGSFNEEEEQIIIDVHRILGNK-WAQIAKHLP-GRTDNEVKNFWNS 120
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-241673IPR009057Homeodomain-like
PROSITE profilePS5129417.6531971IPR017930Myb domain
SuperFamilySSF466897.52E-2922118IPR009057Homeodomain-like
SMARTSM007171.1E-122373IPR001005SANT/Myb domain
PfamPF002491.4E-152471IPR001005SANT/Myb domain
CDDcd001674.42E-112771No hitNo description
PROSITE profilePS5129426.44772126IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2574126IPR009057Homeodomain-like
SMARTSM007171.6E-1576124IPR001005SANT/Myb domain
PfamPF002492.6E-1577120IPR001005SANT/Myb domain
CDDcd001676.04E-1279119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MREKWEMKRD EMGHRCCGKH KVKRGLWSPE EDEKLLRYIT THGHPSWSSV PKLAGLQRCG  60
KSCRLRWINY LRPDLRRGSF NEEEEQIIID VHRILGNKWA QIAKHLPGRT DNEVKNFWNS  120
CIKKKLLSQG LDPSTHNLMP SHKRSSSSNN NNIPKPNKTT SIMKNPTDLD QSTTAFSITN  180
INPPTSTKPN KLKSPNQTTI PSQTVIPIND NMSSTQTMIP INDPMSSLLD DENMIPHWSD  240
VDGMAIHEAP MLPSDKAVVG VDDDDLNMDI LFNTPSSSAF DPDFASIFSS AMSIDFNPMD  300
DLGSWTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31241267108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO145174370.0
Genevisible257704_at0.0
Expression AtlasAT3G12720-
AtGenExpressAT3G12720-
ATTED-IIAT3G12720-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G12720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G12720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0395540.0AY039554.1 Arabidopsis thaliana AT3g12720/MBK21_8 mRNA, complete cds.
GenBankAY1021550.0AY102155.1 Arabidopsis thaliana AT3g12720/MBK21_8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566434.10.0myb domain protein 67
TrEMBLQ9LTW20.0Q9LTW2_ARATH; AT3g12720/MBK21_8
STRINGAT3G12720.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79552539
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Nozawa A, et al.
    Construction of a protein library of Arabidopsis transcription factors using a wheat cell-free protein production system and its application for DNA binding analysis.
    Biosci. Biotechnol. Biochem., 2009. 73(7): p. 1661-4
    [PMID:19584551]
  6. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]